PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0324s0021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 708aa    MW: 77962.3 Da    PI: 5.9359
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0324s0021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3392.36.9e-120573922317
                          XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                          el++r w+d ++lkr+ker++        a ++k+++ ++++arrkkmsraQDgiLkYMlk +evcna+GfvYgiip+kgkpv+gasd+L
  Kalax.0324s0021.1.p  57 ELERRIWRDSIKLKRVKERQRLAA--LTLAEKQKSKQSTTDHARRKKMSRAQDGILKYMLKLVEVCNARGFVYGIIPDKGKPVSGASDNL 144
                          9*****************999643..333234444456789************************************************* PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHH CS
                 EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelww 181
                          r+WWke v+fd+n +aa+ ky+a++l++++ + + + + ++  +l++lqD+tlgSLLs+l+qhcdppqr++plekg++pPWWPtG+e+ww
  Kalax.0324s0021.1.p 145 RGWWKETVKFDKNSTAALDKYEAECLAMGKLNAN-V-NGNSRGMLQDLQDATLGSLLSSLIQHCDPPQRKYPLEKGIPPPWWPTGEEDWW 232
                          ***************************9976666.4.89999************************************************ PP

                          HHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXX CS
                 EIN3 182 gelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slr 268
                           +lgl+++q+ ppy+kphdlkk+wkv+vLtavikhmsp+i++i++l +qsk+lqdkm+ake+ ++l+vl++ee+++    ++  s  s  
  Kalax.0324s0021.1.p 233 VKLGLPASQS-PPYRKPHDLKKMWKVGVLTAVIKHMSPDITKIKRLILQSKCLQDKMTAKETTIWLAVLSHEESLISLTITSdlSDvSGD 321
                          *********9.9**************************************************************9976555545335444 PP

                          XXXXXXXXXXXXXXXXX.............XXXXXX.XXXXXXXXXX...................XXXXXXXXXXXXXXX CS
                 EIN3 269 kqspkvtlsceqkedve.............gkkeskikhvqavktta...................gfpvvrkrkkkpses 317
                           qs + ++ +e++ dv              g           +++t                    g +v ++ kk+ps++
  Kalax.0324s0021.1.p 322 GQSGNRQVATENNHDVSitdvevasglpkkG----------RKNQTVdsvvesqlhvestrnpirvGKQVKNRGKKQPSKR 392
                          5777888888888888865644444432221..........2222223444444555666666666333333333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.1E-11757304No hitNo description
Gene3DG3DSA:1.10.3180.107.4E-68180308IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.66E-59186306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MAAAEMAIVV AGAEDIRHDN CSDIEVDEIK YDDLGEKDGS DDLAEKDVSD EEIDAKELER  60
RIWRDSIKLK RVKERQRLAA LTLAEKQKSK QSTTDHARRK KMSRAQDGIL KYMLKLVEVC  120
NARGFVYGII PDKGKPVSGA SDNLRGWWKE TVKFDKNSTA ALDKYEAECL AMGKLNANVN  180
GNSRGMLQDL QDATLGSLLS SLIQHCDPPQ RKYPLEKGIP PPWWPTGEED WWVKLGLPAS  240
QSPPYRKPHD LKKMWKVGVL TAVIKHMSPD ITKIKRLILQ SKCLQDKMTA KETTIWLAVL  300
SHEESLISLT ITSDLSDVSG DGQSGNRQVA TENNHDVSIT DVEVASGLPK KGRKNQTVDS  360
VVESQLHVES TRNPIRVGKQ VKNRGKKQPS KRNPVIQDGT PQSSDNLPVE EVRSAPLNQL  420
TDSVGDRPPH NDGHSVSAGY EVNAAEKNRK RRRVSHDPVA RGPGLQSKNS FVAEDVLSVS  480
ADKNHVEASS FEIQAHYTSH QNKQPVILQQ SQENDLGAQP YRVLPATNLS PAQSMYLGWL  540
PLPSSVPHPA ANNCGTEHQM YNASGNYGTN YIQSSGTAAY EHAQNGLQDA VIQPQILQDQ  600
PAGLAVRVDS NPYVVGTFHN GARKEVAEGY LNPDALGNDN SQILVTGGGL NPCVQGTLDS  660
NQDMPFEGLD FSFNDMPMDF EGFNSPLSLN DLDFFLNDSD MLEHMAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-7018630711132ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1448452RKRRR
2449453KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037881.11e-168PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLB9GMA11e-165B9GMA1_POPTR; ETHYLENE-INSENSITIVE3-like 3 family protein
STRINGPOPTR_0001s05360.11e-165(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-141ETHYLENE-INSENSITIVE3-like 3